PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10006684m
Common NameCARUB_v10006684mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 264aa    MW: 29990.8 Da    PI: 8.3826
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10006684mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.45.1e-161764148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT  Ed++l d+++ +G g W+  ++  g++R++k+c++rw +yl
  Carubv10006684m 17 RGAWTDHEDKILRDYITTHGEGKWSILPNQAGLKRCGKSCRLRWKNYL 64
                     89********************************************97 PP

2Myb_DNA-binding52.41.2e-1670114147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+ + +E+el+++++++lG++ W++Ia +++ gRt++++k++w++ 
  Carubv10006684m  70 RGNISSDEEELIIRLHNLLGNR-WSLIAGRLP-GRTDNEIKNHWNSN 114
                      78999*****************.*********.***********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.2691264IPR017930Myb domain
SuperFamilySSF466891.21E-2715111IPR009057Homeodomain-like
SMARTSM007177.3E-121666IPR001005SANT/Myb domain
PfamPF002497.1E-131764IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.7E-221871IPR009057Homeodomain-like
CDDcd001671.14E-81964No hitNo description
PROSITE profilePS5129424.56465119IPR017930Myb domain
SMARTSM007172.1E-1569117IPR001005SANT/Myb domain
PfamPF002491.5E-1470114IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.3E-2372119IPR009057Homeodomain-like
CDDcd001678.36E-1174115No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006633Biological Processfatty acid biosynthetic process
GO:0006970Biological Processresponse to osmotic stress
GO:0010023Biological Processproanthocyanidin biosynthetic process
GO:0090379Biological Processsecondary cell wall biogenesis involved in seed trichome differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 264 aa     Download sequence    Send to blast
MGKRGTSTTV KREELNRGAW TDHEDKILRD YITTHGEGKW SILPNQAGLK RCGKSCRLRW  60
KNYLRPGIKR GNISSDEEEL IIRLHNLLGN RWSLIAGRLP GRTDNEIKNH WNSNLRKRLP  120
KTQTNQPKRT KNSIKNENNV CVIRTKAIRC SKSLLFSDLS LQKQTSIISP VLLKDQDMEQ  180
GGSSSLMGDL EFDFDKIQSE FLFPDLMDFD GLDCGNVTSL VSSNEILGDL VPHGQGNLDL  240
NRPFTSYHHQ HGDDEDWLGD FNC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-261411924128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3719810.0AF371981.2 Arabidopsis thaliana putative transcription factor MYB123 (MYB123) mRNA, complete cds.
GenBankAY5196300.0AY519630.1 Arabidopsis thaliana MYB transcription factor (At5g35550) mRNA, complete cds.
GenBankDQ4470000.0DQ447000.1 Arabidopsis thaliana clone pENTR221-At5g35550 myb family transcription factor (At5g35550) mRNA, complete cds.
GenBankDQ6533180.0DQ653318.1 Arabidopsis thaliana clone 0000017211_0000012024 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006282833.10.0hypothetical protein CARUB_v10006684mg
SwissprotQ9FJA21e-165TT2_ARATH; Transcription factor TT2
TrEMBLR0F2Z70.0R0F2Z7_9BRAS; Uncharacterized protein
STRINGAT5G35550.11e-163(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G35550.11e-166MYB family protein